PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009115317.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family CO-like
Protein Properties Length: 414aa    MW: 46495 Da    PI: 4.8318
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009115317.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box28.33.7e-091356340
        zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvv 40
                    +r C+ + +k+++++C  ++ +lC++C +  H+       H++v
  XP_009115317.1 13 ARACDSCVKKRARWYCAADDAFLCQSCDTLVHSAnplarrHERV 56
                    578*****************************657888888876 PP

2CCT68.12.4e-23356399144
             CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                     Rea+++RY+eKr+tR+F+KkirYe+RK +Ae+RpR+KGrFvk+a
  XP_009115317.1 356 REARVSRYREKRRTRLFSKKIRYEVRKLNAEKRPRMKGRFVKRA 399
                     9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003362.9E-101158IPR000315B-box-type zinc finger
PROSITE profilePS5011910.8791158IPR000315B-box-type zinc finger
PfamPF006434.5E-81356IPR000315B-box-type zinc finger
CDDcd000214.06E-91458No hitNo description
PfamPF062036.8E-18356398IPR010402CCT domain
PROSITE profilePS5101716.083356398IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 414 aa     Download sequence    Send to blast
MKNLANAVGA KTARACDSCV KKRARWYCAA DDAFLCQSCD TLVHSANPLA RRHERVRLKS  60
ASPVATKYSS HNHSASCPPL EAATWHQGFT RKPRTPRGSG KKNNLSIFHD LVPEISAEDQ  120
TDSYEIEEQL ICQVPVLDPM VAEQFLNDVV EPKIEFPMIT IDDQEDEDNA ESCLNGFFPT  180
DMELEEFAAD VEILLGRGLD VTESYAMEEL GLSNTEMFKI EKDEIEEEEG EETKAMNMGI  240
CCGEDRGDGD GTVAFELRFD HDSHNTYEEE AIKNADCIKV EEEEQKNVLM LSLNYESVIS  300
TWGGQGQPWL SREPPERDID ISDKPVVSME INGGESHHKH YVGGCLPSSG FGDGGREARV  360
SRYREKRRTR LFSKKIRYEV RKLNAEKRPR MKGRFVKRAS LALSAASSPL GVNY
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1366382RRTRLFSKKIRYEVRKL
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bra.190240.0bud| flower
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009115317.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
RefseqXP_013642118.10.0PREDICTED: zinc finger protein CONSTANS-LIKE 16-like
SwissprotQ8RWD00.0COL16_ARATH; Zinc finger protein CONSTANS-LIKE 16
TrEMBLM4E7J50.0M4E7J5_BRARP; Uncharacterized protein
STRINGBra024750.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM24672767
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25440.10.0B-box type zinc finger protein with CCT domain